MidgeBase gene description page [Pn.14600]

Outline

Link to gbrowse

Gene ID Pn.14600
Type Protein coding gene
Scaffold PnScaf25000
Start 3996
End 5586
Direction -

Sequence

Transcript: 213 (bp)

 ATGCATCAAGATCAAAATAACGATAAAAACTCGAAACAGAAACGACACCGGACGCGCTTCACACCGGCCCAGCTGAACGAGCTCGAGCGGTGCTTCGGCAAGACGCATTATCCGGACATTTTTATGCGCGAAGAAATTGCTATGAGAATCGGACTAACCGAGTCACGCGTGCAAAGCATCGTTGAGACTTCTTGCGTCGAGGCAGAAGGTATT 

Protein: 71 (aa)

 MHQDQNNDKNSKQKRHRTRFTPAQLNELERCFGKTHYPDIFMREEIAMRIGLTESRVQSIVETSCVEAEGI 
Type Start End Length
CDS 3999 4037 39
CDS 5230 5288 59
CDS 5397 5496 100
CDS 5572 5586 15
intron 4038 5229 1192
intron 5289 5396 108
intron 5497 5571 75

Auto annotation result

Program/Analysis Accession Description Score/Expectation
BLASTP/NCBI-nr XP_001865837 conserved hypothetical protein [Culex quinquefasciatus] gb|EDS42334.1| conserved hypothetical protein [Culex quinquefasciatus] 9e-24
InterPro IPR001356 Homeodomain
InterPro IPR009057 Homeodomain-like
Gene Ontology(BP) GO:0006355 regulation of transcription, DNA-dependent
Gene Ontology(MF) GO:0003677 DNA binding
Gene Ontology(MF) GO:0043565 sequence-specific DNA binding
Gene Ontology(MF) GO:0003700 sequence-specific DNA binding transcription factor activity
Pfam PF08880.6 QLQ 0.12
Pfam PF00046.24 Homeobox domain 2.5e-15

Expression level (RPKM)

Paralog/Ortholog genes

Paralogous genes

Gene ID

Orthologous genes

Species Gene ID
D. plexippus DPOGS212645PA
N. vitripennis NV13653-PA
S. invicta SI2.2.0_02202
P. vanderplanki Pv.04898
B. mori BGIBMGA013947-TA
H. melpomene HMEL013631-PA
C. quinquefasciatus CPIJ015363