MidgeBase gene description page [Pn.10119]
Outline
| Gene ID | Pn.10119 |
| Type | Protein coding gene |
| Scaffold | PnScaf10784 |
| Start | 118 |
| End | 692 |
| Direction | + |
Sequence
Transcript: 369 (bp)
ATGACCTCTCGACGCGGCGGAGGAGCCGGCAACATCAACAGCAGCGAGTCGGGAGGAATTTTGTCGAATCGGCTGTCGCTGCCGCTGCCGCTGACGGCGTGCCACCGCTGCGACGTGTGCGGCAAGCTGCTGAGCACGAAGCTCACGCTCAAGCGCCACAAGGAGCAACAGCATCTGCAGCCGCTCAACAGCGCCGTCTGCAACCTCTGCCACAAGGTCTTTCGCACGCTCAACAGCCTCAACAACCACAAGAGCATCTACCATCGTCGGCAGAAAAACCATCTCTACTCGGTGCATCCCTCCGCGCAAACCCTGCCGCCGCATCTCACGCAACTCCAGCAGCCCAACCCGCAGAAGCTTGACTTCATC
Protein: 123 (aa)
MTSRRGGGAGNINSSESGGILSNRLSLPLPLTACHRCDVCGKLLSTKLTLKRHKEQQHLQPLNSAVCNLCHKVFRTLNSLNNHKSIYHRRQKNHLYSVHPSAQTLPPHLTQLQQPNPQKLDFI
| Type | Start | End | Length |
| CDS |
118 |
130 |
13 |
| CDS |
334 |
689 |
356 |
| intron |
131 |
333 |
203 |
Auto annotation result
| Program/Analysis | Accession | Description | Score/Expectation |
| BLASTP/NCBI-nr |
XP_001659217 |
broad-complex core-protein [Aedes aegypti] gb|EAT39791.1| broad-complex core-protein [Aedes aegypti] |
2e-35 |
| InterPro |
IPR015880 |
Zinc finger, C2H2-like |
|
| InterPro |
IPR007087 |
Zinc finger, C2H2 |
|
| Gene Ontology(CC) |
GO:0005622 |
intracellular |
|
| Gene Ontology(MF) |
GO:0008270 |
zinc ion binding |
|
| Pfam |
PF12156.3 |
Putative metal-binding domain of cation transport ATPase |
0.09 |
| Pfam |
PF13894.1 |
C2H2-type zinc finger |
0.00026 |
| Pfam |
PF13912.1 |
C2H2-type zinc finger |
0.004 |
| Pfam |
PF00096.21 |
Zinc finger, C2H2 type |
0.00039 |
| Pfam |
PF02892.10 |
BED zinc finger |
1.5 |
| Pfam |
PF01363.16 |
FYVE zinc finger |
0.024 |
| Pfam |
PF14353.1 |
CpXC protein |
0.47 |
| Pfam |
PF12874.2 |
Zinc-finger of C2H2 type |
0.029 |
| Pfam |
PF12171.3 |
Zinc-finger double-stranded RNA-binding |
0.0022 |
| Pfam |
PF13465.1 |
Zinc-finger double domain |
5.8 |
| Pfam |
PF13435.1 |
Cytochrome c554 and c-prime |
0.03 |
| Pfam |
PF06467.9 |
MYM-type Zinc finger with FCS sequence motif |
0.15 |
Expression level (RPKM)
Paralog/Ortholog genes
Paralogous genes
Orthologous genes
| Species |
Gene ID |
| D. plexippus |
DPOGS207436PA |
| P. vanderplanki |
Pv.06469 |
| B. mori |
BGIBMGA009908-TA |
| T. castaneum |
TC005475 |
| C. quinquefasciatus |
CPIJ003270 |
| S. invicta |
SI2.2.0_06507 |
| A. gambiae |
AGAP002164 |