MidgeBase gene description page [Pn.09710]

Outline

Link to gbrowse

Gene ID Pn.09710
Type Protein coding gene
Scaffold PnScaf10058
Start 24202
End 24494
Direction +

Sequence

Transcript: 225 (bp)

 ATGCTGAATAAGGTAGATATCGAGGCAAATGTTGAAGGAGGCGGACAATCTGGGCAGGCTGGTGCAATAAGATGGGGAATTTCAATGGCACTGAGGAGTTTTGTGGATCCCGAGACTGTTGAAAAAATGCGATATGCCGGTTTACTACAGAGAGATTACCGTACAAAGGAGAGGAAGAAGCCTGGTCAAGAAGGCGCACGAAGAAAGTTCACGTGGAAGAAACGC 

Protein: 75 (aa)

 MLNKVDIEANVEGGGQSGQAGAIRWGISMALRSFVDPETVEKMRYAGLLQRDYRTKERKKPGQEGARRKFTWKKR 
Type Start End Length
CDS 24202 24337 136
CDS 24403 24491 89
intron 24338 24402 65

Auto annotation result

Program/Analysis Accession Description Score/Expectation
BLASTP/NCBI-nr XP_001661636 mitochondrial ribosomal protein, S9, putative [Aedes aegypti] gb|EAT36526.1| mitochondrial ribosomal protein, S9, putative [Aedes aegypti] 7e-28
InterPro IPR000754 Ribosomal protein S9
InterPro IPR020568 Ribosomal protein S5 domain 2-type fold
InterPro IPR014721 Ribosomal protein S5 domain 2-type fold, subgroup
Gene Ontology(BP) GO:0006412 translation
Gene Ontology(CC) GO:0005840 ribosome
Gene Ontology(CC) GO:0005622 intracellular
Gene Ontology(MF) GO:0003735 structural constituent of ribosome
Pfam PF00380.14 Ribosomal protein S9/S16 9.7e-23

Expression level (RPKM)

Paralog/Ortholog genes

Paralogous genes

Gene ID

Orthologous genes

Species Gene ID
A. gambiae AGAP010270
N. vitripennis NV23872-PA
T. castaneum TC002716