MidgeBase gene description page [Pn.09012]
Outline
| Gene ID | Pn.09012 |
| Type | Protein coding gene |
| Scaffold | PnScaf8963 |
| Start | 315 |
| End | 4533 |
| Direction | - |
Sequence
Transcript: 690 (bp)
ATGGATTTAATAATAGAGCAAGAGGCGACAAATCTAAATACGATTGCGGCTCTCTCGATGTCGGCGATGAAGGCGGACAACAACCATAGCGCCGTCAACAAGCACGTTCAGACGGAATACATCAAGAACTCCTCGGACGGAACAATCATCGAGTACCAGCAATCGCCGTCCGCCGTGCGCGCCGCTTTCTACAACTTGCCCGCGTGCGAACCCATCGAGATCTCATTCAAAGACGTTTCCTATTCCGTCCAGAAAATGTTCTCTAAAACTCGCAAGGAGATCCTCCACAAAGTCAGCGGAAATTTTCCCAGTGGAAATCTCATCGCAATCATGGGGCCGAGCGGTGCAGGAAAGTCAACTCTCCTGAACGCTTTATCCGGATACAAGACGAGAAACGTGAGCGGCGCGATTTATGTGAACGGAAGAATTCGTGATTTGAATGAATTCAAGAAATCAACATGCTACATAACTCAAGACGACAGACTGCAGCTCCTGCTCACCGTGTACGAGAACATGAAGATTGCTGCCGACCTGAAGCTCGGAAATAACGTCAATGAGATGGAGAAGAATGCCAGACGGAACGGCGCGAACATTATTAGCCTAATCATCCGCTTTACAACCATAATAAAATACTTTGCATTTCAAACATTCCATCTCCATGACGCGCACAACGTTGAAAGCGAAATTCGA
Protein: 230 (aa)
MDLIIEQEATNLNTIAALSMSAMKADNNHSAVNKHVQTEYIKNSSDGTIIEYQQSPSAVRAAFYNLPACEPIEISFKDVSYSVQKMFSKTRKEILHKVSGNFPSGNLIAIMGPSGAGKSTLLNALSGYKTRNVSGAIYVNGRIRDLNEFKKSTCYITQDDRLQLLLTVYENMKIAADLKLGNNVNEMEKNARRNGANIISLIIRFTTIIKYFAFQTFHLHDAHNVESEIR
| Type | Start | End | Length |
| CDS |
318 |
431 |
114 |
| CDS |
1447 |
1583 |
137 |
| CDS |
1663 |
1752 |
90 |
| CDS |
2164 |
2178 |
15 |
| CDS |
2256 |
2321 |
66 |
| CDS |
4266 |
4533 |
268 |
| intron |
432 |
1446 |
1015 |
| intron |
1584 |
1662 |
79 |
| intron |
1753 |
2163 |
411 |
| intron |
2179 |
2255 |
77 |
| intron |
2322 |
4265 |
1944 |
Auto annotation result
| Program/Analysis | Accession | Description | Score/Expectation |
| BLASTP/NCBI-nr |
XP_001653364 |
abc transporter [Aedes aegypti] gb|EAT39584.1| abc transporter [Aedes aegypti] |
2e-45 |
| InterPro |
IPR020064 |
ABC transporter, G1-like |
|
| InterPro |
IPR004881 |
Ribosome biogenesis GTPase RsgA, putative |
|
| Gene Ontology(CC) |
GO:0016021 |
integral to membrane |
|
| Gene Ontology(MF) |
GO:0005524 |
ATP binding |
|
| Gene Ontology(MF) |
GO:0005525 |
GTP binding |
|
| Gene Ontology(MF) |
GO:0003924 |
GTPase activity |
|
| Pfam |
PF13207.1 |
AAA domain |
2.2e-05 |
| Pfam |
PF08477.8 |
Miro-like protein |
0.072 |
| Pfam |
PF03205.9 |
Molybdopterin guanine dinucleotide synthesis protein B |
0.085 |
| Pfam |
PF12846.2 |
AAA-like domain |
0.0084 |
| Pfam |
PF01695.12 |
IstB-like ATP binding protein |
0.024 |
| Pfam |
PF13245.1 |
Part of AAA domain |
0.071 |
| Pfam |
PF00735.13 |
Septin |
0.03 |
| Pfam |
PF00350.18 |
Dynamin family |
0.0024 |
| Pfam |
PF13401.1 |
AAA domain |
0.0051 |
| Pfam |
PF02421.13 |
Ferrous iron transport protein B |
0.26 |
| Pfam |
PF00006.20 |
ATP synthase alpha/beta family, nucleotide-binding domain |
0.0035 |
| Pfam |
PF13238.1 |
AAA domain |
0.00033 |
| Pfam |
PF00005.22 |
ABC transporter |
0.0021 |
| Pfam |
PF13476.1 |
AAA domain |
6e-05 |
| Pfam |
PF02492.14 |
CobW/HypB/UreG, nucleotide-binding domain |
0.03 |
| Pfam |
PF13304.1 |
AAA domain |
4e-05 |
| Pfam |
PF13175.1 |
AAA ATPase domain |
0.051 |
| Pfam |
PF06964.7 |
Alpha-L-arabinofuranosidase C-terminus |
0.071 |
| Pfam |
PF13481.1 |
AAA domain |
0.00064 |
| Pfam |
PF00910.17 |
RNA helicase |
0.073 |
| Pfam |
PF06745.8 |
KaiC |
0.051 |
| Pfam |
PF13191.1 |
AAA ATPase domain |
0.00067 |
| Pfam |
PF13604.1 |
AAA domain |
0.054 |
| Pfam |
PF13521.1 |
AAA domain |
0.00045 |
| Pfam |
PF03215.10 |
Rad17 cell cycle checkpoint protein |
0.0025 |
| Pfam |
PF01637.13 |
Archaeal ATPase |
0.0021 |
| Pfam |
PF13555.1 |
P-loop containing region of AAA domain |
5e-05 |
| Pfam |
PF13671.1 |
AAA domain |
0.022 |
| Pfam |
PF05783.6 |
Dynein light intermediate chain (DLIC) |
0.0045 |
| Pfam |
PF01926.18 |
50S ribosome-binding GTPase |
6.4e-05 |
| Pfam |
PF00437.15 |
Type II/IV secretion system protein |
0.012 |
| Pfam |
PF09624.5 |
Protein of unknown function (DUF2393) |
0.034 |
| Pfam |
PF03029.12 |
Conserved hypothetical ATP binding protein |
0.043 |
| Pfam |
PF13173.1 |
AAA domain |
0.008 |
| Pfam |
PF03308.11 |
ArgK protein |
0.023 |
| Pfam |
PF03193.11 |
Protein of unknown function, DUF258 |
3.2e-07 |
Expression level (RPKM)
Paralog/Ortholog genes
Paralogous genes
Orthologous genes