MidgeBase gene description page [Pn.07811]

Outline

Link to gbrowse

Gene ID Pn.07811
Type Protein coding gene
Scaffold PnScaf7224
Start 2378
End 3043
Direction -

Sequence

Transcript: 315 (bp)

 ATGAATATTCACTTTTCTGCTGATTTTGATGCACAACTTGAGAAAGCTGGAGATCGATTGGTAGTTGTAGATTTCTTCGCAACATGGTGTGGTCCATGCAAAATGATTGCACCAAAACTCGAAGAATTTCAAAACACATATGTTGACAAAGTTGTCATCATTAAAGTTGATGTTGACGAATGTGAAGAAATCGCAGTGAAATACAACATTTCATCGATGCCAACGTTCGTATTCATTAAAAAGGGTCAGCAAATCGATAGCTTCTCGGGAGCAAATCCTGAAAAACTTGAAAAATACATCACTCAGCACTCAGTA 

Protein: 105 (aa)

 MNIHFSADFDAQLEKAGDRLVVVDFFATWCGPCKMIAPKLEEFQNTYVDKVVIIKVDVDECEEIAVKYNISSMPTFVFIKKGQQIDSFSGANPEKLEKYITQHSV 
Type Start End Length
CDS 2381 2530 150
CDS 2741 2887 147
CDS 3026 3043 18
intron 2531 2740 210
intron 2888 3025 138

Auto annotation result

Program/Analysis Accession Description Score/Expectation
BLASTP/NCBI-nr XP_001861983 conserved hypothetical protein [Culex quinquefasciatus] gb|EDS36322.1| conserved hypothetical protein [Culex quinquefasciatus] 3e-37
InterPro IPR005746 Thioredoxin
InterPro IPR013766 Thioredoxin domain
InterPro IPR012336 Thioredoxin-like fold
InterPro IPR017937 Thioredoxin, conserved site
Gene Ontology(BP) GO:0006662 glycerol ether metabolic process
Gene Ontology(BP) GO:0045454 cell redox homeostasis
Gene Ontology(MF) GO:0015035 protein disulfide oxidoreductase activity
Gene Ontology(MF) GO:0009055 electron carrier activity
Pfam PF01323.15 DSBA-like thioredoxin domain 0.11
Pfam PF13905.1 Thioredoxin-like 3.1e-11
Pfam PF13848.1 Thioredoxin-like domain 0.029
Pfam PF11948.3 Protein of unknown function (DUF3465) 0.11
Pfam PF13899.1 Thioredoxin-like 2.5e-05
Pfam PF07449.6 Hydrogenase-1 expression protein HyaE 0.0013
Pfam PF13728.1 F plasmid transfer operon protein 0.0031
Pfam PF00578.16 AhpC/TSA family 1.7e-05
Pfam PF08534.5 Redoxin 5.8e-05
Pfam PF02966.11 Mitosis protein DIM1 0.00081
Pfam PF13098.1 Thioredoxin-like domain 5.2e-10
Pfam PF00085.15 Thioredoxin 1.9e-33
Pfam PF13462.1 Thioredoxin 0.05

Expression level (RPKM)

Paralog/Ortholog genes

Paralogous genes

Gene ID

Orthologous genes

Species Gene ID
S. invicta SI2.2.0_04506
B. mori BGIBMGA008120-TA
D. melanogaster FBgn0040070
M. musculus ENSMUSG00000028367
H. melpomene HMEL015667-PA
D. melanogaster FBgn0029752
A. mellifera GB15855-PA
C. quinquefasciatus CPIJ012011
D. plexippus DPOGS201640PA
A. gambiae AGAP009584
P. vanderplanki Pv.07218
P. humanus PHUM156960-PA
N. vitripennis NV13156-PA
H. sapiens ENSP00000363641
H. melpomene HMEL015666-PA
T. castaneum TC015376
A. aegypti AAEL010777