MidgeBase gene description page [Pn.06838]

Outline

Link to gbrowse

Gene ID Pn.06838
Type Protein coding gene
Scaffold PnScaf6051
Start 71185
End 71723
Direction -

Sequence

Transcript: 408 (bp)

 ATGGCACGTACAAAGCAAACCGCTCGTAAATCGACTGGAGGAAAGGCTCCTCGTAAGCAATTGGCCACAAAGGCCGCTCGTAAGTCAGCACCAAGCACCGGAGGTGTCAAGAAACCTCATCGTTATCGTCCCGGTACAGTCGCTCTTCGTGAGATTCGTCGCTACCAGAAATCTACCGAATTGTTGATCCGCAAATTGCCATTCCAACGTCTTGTTCGTGAGATTGCTCAGGATTTCAAGACTGATTTGCGTTTCCAGTCGGCTGCCATTGGTGCACTCCAAGAAGCATCAGAGGCATACTTGGTCGGTCTCTTCGAAGACACCAACTTGTGCGCTATTCATGCCAAGCGTGTCACAATTATGCCCAAGGACATTCAACTCGCCCGTCGTATTCGCGGTGAACGTGCT 

Protein: 136 (aa)

 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 
Type Start End Length
CDS 71188 71226 39
CDS 71294 71647 354
CDS 71709 71723 15
intron 71227 71293 67
intron 71648 71708 61

Auto annotation result

Program/Analysis Accession Description Score/Expectation
BLASTP/NCBI-nr NP_002098 histone H3.3 [Homo sapiens] ref|NP_005315.1| histone H3.3 [Homo sapiens] ref|NP_032236.1| histone H3.3 [Mus musculus] ref|NP_032237.1| histone H3.3 [Mus musculus] ref|NP_446437.1| histone H3.3 [Rattus norvegicus] ref|NP_511095.1| histone H3.3B, isoform A [Drosophila melanogaster] ref|NP_523479.1| histone H3.3A, isoform A [Drosophila melanogaster] ref|NP_727314.1| histone H3.3B, isoform B [Drosophila melanogaster] ref|NP_788892.1| histone H3.3B, isoform C [Drosophila melanogaster] ref|NP_956297.1| H3 histone, family 3C [Danio rerio] ref|NP_957395.1| H3 histone, family 3D [Danio rerio] ref|NP_989026.1| histone H3.3 [Xenopus (Silurana) tropicalis] ref|NP_990627.1| histone H3.3 [Gallus gallus] ref|NP_999095.1| histone H3.3 [Sus scrofa] ref|NP_001005101.1| H3 histone, family 3A [Xenopus (Silurana) tropicalis] ref|NP_001014411.1| histone H3.3 [Bos taurus] ref|NP_001017599.1| histone H3.3 [Danio rerio] ref|NP_001080065.1| H3 histone, family 3B (H3.3B) [Xenopus laevis] ref|NP_001086074.1| histone cluster 2, H3d [Xenopus laevis] ref|NP_001085048.1| H3 histone, family 3B (H3.3B) [Xenopus laevis] ref|NP_001079375.1| histone H3.3 [Xenopus laevis] ref|NP_001091756.1| h3 histone family 3a [Bombyx mori] ref|NP_001091902.1| H3 histone, family 3A [Xenopus laevis] ref|NP_001092038.1| histone cluster 1, H3a [Pan troglodytes] ref|NP_001162389.1| histone H3.1 [Papio anubis] ref|NP_001164583.1| histone H3.3 [Oryctolagus cuniculus] ref|NP_001184227.1| H3 histone, family 3A member [Taeniopygia guttata] ref|NP_001184233.1| H3 histone, family 3A member [Taeniopygia guttata] ref|NP_001191424.1| histone 3 [Aplysia californica] ref|NP_001229500.1| H3 histone, family 3B [Bos taurus] ref|XP_321242.1| AGAP001813-PA [Anopheles gambiae str. PEST] ref|XP_537232.1| PREDICTED: histone H3.3 isoform 1 [Canis lupus familiaris] ref|XP_624499.1| PREDICTED: histone H3.3-like isoform 2 [Apis mellifera] ref|XP_858804.1| PREDICTED: histone H3.3 isoform 4 [Canis lupus familiaris] ref|XP_975889.1| PREDICTED: similar to Histone H3.3B CG8989-PA isoform 2 [Tribolium castaneum] ref|XP_001091581.1| PREDICTED: histone H3.3-like isoform 1 [Macaca mulatta] ref|XP_001091695.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta] ref|XP_001091816.1| PREDICTED: histone H3.3-like isoform 3 [Macaca mulatta] ref|XP_001092054.1| PREDICTED: histone H3.3-like isoform 5 [Macaca mulatta] ref|XP_001083683.1| PREDICTED: histone H3.3-like [Macaca mulatta] ref|XP_001099829.1| PREDICTED: histone H3.3-like isoform 1 [Macaca mulatta] ref|XP_001100109.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta] ref|XP_001120696.1| PREDICTED: histone H3.3-like isoform 1 [Apis mellifera] ref|XP_001146144.1| PREDICTED: hypothetical protein LOC738262 isoform 3 [Pan troglodytes] ref|XP_001146227.1| PREDICTED: hypothetical protein LOC738262 isoform 4 [Pan troglodytes] ref|XP_001146311.1| PREDICTED: hypothetical protein LOC738262 isoform 5 [Pan troglodytes] ref|XP_001355964.1| GA19158 [Drosophila pseudoobscura pseudoobscura] ref|XP_001368225.1| PREDICTED: histone H3.3-like [Monodelphis domestica] ref|XP_001369359.1| PREDICTED: histone H3.3-like isoform 1 [Monodelphis domestica] ref|XP_001369390.1| PREDICTED: histone H3.3-like isoform 2 [Monodelphis domestica] ref|XP_001514538.1| PREDICTED: histone H3.3-like [Ornithorhynchus anatinus] ref|XP_001495110.1| PREDICTED: histone H3.3-like isoform 1 [Equus caballus] ref|XP_001489292.1| PREDICTED: histone H3.3-like [Equus caballus] ref|XP_001608166.1| PREDICTED: histone H3.3-like isoform 2 [Nasonia vitripennis] ref|XP_001608174.1| PREDICTED: histone H3.3-like [Nasonia vitripennis] ref|XP_001657554.1| histone H3.3 [Aedes aegypti] ref|XP_001867328.1| histone H3.3 type 2 [Culex quinquefasciatus] ref|XP_001897416.1| Histone H3.3 [Brugia malayi] ref|XP_001899461.1| Histone H3.3 [Brugia malayi] ref|XP_001949472.1| PREDICTED: histone H3.3-like [Acyrthosiphon pisum] ref|XP_001962995.1| GF15720 [Drosophila ananassae] ref|XP_001966717.1| GF19171 [Drosophila ananassae] ref|XP_001968765.1| GG25048 [Drosophila erecta] ref|XP_001977366.1| GG19000 [Drosophila erecta] ref|XP_001989021.1| GH11489 [Drosophila grimshawi] ref|XP_001992391.1| GH24723 [Drosophila grimshawi] ref|XP_002001685.1| GI16984 [Drosophila mojavensis] ref|XP_002010097.1| GI14879 [Drosophila mojavensis] ref|XP_002021511.1| GL26550 [Drosophila persimilis] ref|XP_002025032.1| GL26831 [Drosophila persimilis] ref|XP_002037914.1| GM18523 [Drosophila sechellia] ref|XP_002043987.1| GM13676 [Drosophila sechellia] ref|XP_002051859.1| GJ17231 [Drosophila virilis] ref|XP_002058949.1| GJ15308 [Drosophila virilis] ref|XP_002064500.1| GK23881 [Drosophila willistoni] ref|XP_002071382.1| GK25162 [Drosophila willistoni] ref|XP_002088675.1| His3.3A [Drosophila yakuba] ref|XP_002101068.1| GE17412 [Drosophila yakuba] ref|XP_002078203.1| GD23319 [Drosophila simulans] ref|XP_002119783.1| PREDICTED: similar to Histone H3.3B CG8989-PA [Ciona intestinalis] ref|XP_002134231.1| GA22698 [Drosophila pseudoobscura pseudoobscura] ref|XP_002399568.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis] ref|XP_002430660.1| histone H3.3 [Pediculus humanus corporis] ref|XP_002589240.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae] ref|XP_002595623.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae] ref|XP_002732446.1| PREDICTED: histone H3.3B-like isoform 1 [Saccoglossus kowalevskii] ref|XP_002732447.1| PREDICTED: histone H3.3B-like isoform 2 [Saccoglossus kowalevskii] ref|XP_002732967.1| PREDICTED: histone H3.3B-like [Saccoglossus kowalevskii] ref|XP_002717527.1| PREDICTED: H3 histone, family 3A [Oryctolagus cuniculus] ref|XP_002664801.1| PREDICTED: histone H3.3-like isoform 2 [Danio rerio] ref|XP_002724941.1| PREDICTED: histone H3.3B-like [Rattus norvegicus] ref|XP_002728089.1| PREDICTED: histone H3.3B-like [Rattus norvegicus] ref|XP_002745966.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] ref|XP_002745967.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] ref|XP_002748789.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] ref|XP_002748790.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] ref|XP_002753909.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] ref|XP_002753910.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] ref|XP_002753911.1| PREDICTED: histone H3.3-like isoform 3 [Callithrix jacchus] ref|XP_002760051.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] ref|XP_002760632.1| PREDICTED: histone H3.3-like isoform 1 [Callithrix jacchus] ref|XP_002760633.1| PREDICTED: histone H3.3-like isoform 2 [Callithrix jacchus] ref|XP_002760634.1| PREDICTED: histone H3.3-like isoform 3 [Callithrix jacchus] ref|XP_002800646.1| PREDICTED: histone H3.3-like [Macaca mulatta] ref|XP_002800647.1| PREDICTED: histone H3.3-like [Macaca mulatta] ref|XP_002801958.1| PREDICTED: histone H3.3-like [Macaca mulatta] ref|XP_002801959.1| PREDICTED: histone H3.3-like [Macaca mulatta] ref|XP_002802116.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta] ref|XP_002809431.1| PREDICTED: histone H3.3-like isoform 1 [Pongo abelii] ref|XP_002809432.1| PREDICTED: histone H3.3-like isoform 2 [Pongo abelii] ref|XP_002809433.1| PREDICTED: histone H3.3-like isoform 3 [Pongo abelii] ref|XP_002809434.1| PREDICTED: histone H3.3-like isoform 4 [Pongo abelii] ref|XP_002809435.1| PREDICTED: histone H3.3-like isoform 5 [Pongo abelii] ref|XP_002809436.1| PREDICTED: histone H3.3-like isoform 6 [Pongo abelii] ref|XP_002809437.1| PREDICTED: histone H3.3-like isoform 7 [Pongo abelii] ref|XP_002940033.1| PREDICTED: histone H3.3 [Xenopus (Silurana) tropicalis] ref|XP_002919897.1| PREDICTED: histone H3.3-like [Ailuropoda melanoleuca] ref|XP_002926741.1| PREDICTED: histone H3.3-like [Ailuropoda melanoleuca] ref|XP_003131242.1| PREDICTED: histone H3.3-like [Sus scrofa] ref|XP_003140744.1| H3 histone, family 3A [Loa loa] ref|XP_003149523.1| histone H3 [Loa loa] ref|XP_003211494.1| PREDICTED: histone H3.3-like [Meleagris gallopavo] ref|XP_003216117.1| PREDICTED: histone H3.3-like [Anolis carolinensis] ref|XP_003217253.1| PREDICTED: histone H3.3-like [Anolis carolinensis] ref|XP_003222905.1| PREDICTED: histone H3.3-like [Anolis carolinensis] ref|XP_003249043.1| PREDICTED: histone H3.3-like [Acyrthosiphon pisum] ref|XP_003250201.1| PREDICTED: histone H3.3-like isoform 1 [Apis mellifera] ref|XP_003250202.1| PREDICTED: histone H3.3-like isoform 2 [Apis mellifera] ref|XP_003263420.1| PREDICTED: histone H3.3-like [Nomascus leucogenys] ref|XP_003275139.1| PREDICTED: histone H3.3-like isoform 1 [Nomascus leucogenys] ref|XP_003275140.1| PREDICTED: histone H3.3-like isoform 2 [Nomascus leucogenys] ref|XP_003275141.1| PREDICTED: histone H3.3-like isoform 3 [Nomascus leucogenys] ref|XP_003275142.1| PREDICTED: histone H3.3-like isoform 4 [Nomascus leucogenys] ref|XP_003275143.1| PREDICTED: histone H3.3-like isoform 5 [Nomascus leucogenys] ref|XP_003275144.1| PREDICTED: histone H3.3-like isoform 6 [Nomascus leucogenys] ref|XP_003275145.1| PREDICTED: histone H3.3-like isoform 7 [Nomascus leucogenys] ref|XP_003279136.1| PREDICTED: histone H3.3-like isoform 1 [Nomascus leucogenys] ref|XP_003279137.1| PREDICTED: histone H3.3-like isoform 2 [Nomascus leucogenys] ref|XP_003279138.1| PREDICTED: histone H3.3-like isoform 3 [Nomascus leucogenys] ref|XP_003308826.1| PREDICTED: histone H3.3-like isoform 1 [Pan troglodytes] ref|XP_003308827.1| PREDICTED: histone H3.3-like isoform 2 [Pan troglodytes] ref|XP_003339055.1| PREDICTED: histone H3.3-like [Pan troglodytes] ref|XP_003308828.1| PREDICTED: histone H3.3-like isoform 3 [Pan troglodytes] ref|XP_003308830.1| PREDICTED: histone H3.3-like isoform 5 [Pan troglodytes] ref|XP_003339056.1| PREDICTED: histone H3.3-like [Pan troglodytes] ref|XP_003339057.1| PREDICTED: histone H3.3-like [Pan troglodytes] ref|XP_003308831.1| PREDICTED: histone H3.3-like isoform 6 [Pan troglodytes] ref|XP_001145904.2| PREDICTED: hypothetical protein LOC738262 isoform 1 [Pan troglodytes] ref|XP_003315782.1| PREDICTED: hypothetical protein LOC738262 [Pan troglodytes] ref|XP_003315783.1| PREDICTED: hypothetical protein LOC738262 [Pan troglodytes] ref|XP_003315784.1| PREDICTED: hypothetical protein LOC738262 [Pan troglodytes] ref|XP_003386893.1| PREDICTED: histone H3.3-like [Amphimedon queenslandica] ref|XP_003400767.1| PREDICTED: histone H3.3-like [Bombus terrestris] ref|XP_003400771.1| PREDICTED: histone H3.3 isoform 1 [Bombus terrestris] ref|XP_003400772.1| PREDICTED: histone H3.3 isoform 2 [Bombus terrestris] ref|XP_003400773.1| PREDICTED: histone H3.3 isoform 3 [Bombus terrestris] ref|XP_003400774.1| PREDICTED: histone H3.3 isoform 4 [Bombus terrestris] ref|XP_003400775.1| PREDICTED: histone H3.3 isoform 5 [Bombus terrestris] ref|XP_003400776.1| PREDICTED: histone H3.3 isoform 6 [Bombus terrestris] ref|XP_003410978.1| PREDICTED: histone H3.3-like [Loxodonta africana] ref|XP_003417304.1| PREDICTED: histone H3.3-like [Loxodonta africana] ref|XP_003435952.1| AGAP001813-PB [Anopheles gambiae str. PEST] ref|XP_003438715.1| PREDICTED: histone H3.3-like [Oreochromis niloticus] ref|XP_003438823.1| PREDICTED: histone H3.3-like [Oreochromis niloticus] ref|XP_003449844.1| PREDICTED: histone H3.3-like [Oreochromis niloticus] ref|XP_003461470.1| PREDICTED: histone H3.3-like [Cavia porcellus] ref|XP_003462414.1| PREDICTED: histone H3.3-like [Cavia porcellus] ref|XP_003485151.1| PREDICTED: histone H3.3-like [Bombus impatiens] ref|XP_003485156.1| PREDICTED: histone H3.3-like isoform 1 [Bombus impatiens] ref|XP_003485157.1| PREDICTED: histone H3.3-like isoform 2 [Bombus impatiens] ref|XP_003643522.1| PREDICTED: histone H3.3-like [Gallus gallus] sp|P84245.2|H33_RAT RecName: Full=Histone H3.3 sp|P84243.2|H33_HUMAN RecName: Full=Histone H3.3 sp|P84244.2|H33_MOUSE RecName: Full=Histone H3.3 sp|P84246.2|H33_RABIT RecName: Full=Histone H3.3 sp|P84247.2|H33_CHICK RecName: Full=Histone H3.3; AltName: Full=H3.3A/B; AltName: Full=Histone H3 class II sp|P84248.2|H33_SPISO RecName: Full=Histone H3.3 sp|P84249.2|H33_DROME RecName: Full=Histone H3.3; AltName: Full=H3.3Q; AltName: Full=H3.A/B sp|P84250.2|H33_DROHY RecName: Full=Histone H3.3; AltName: Full=H3.A/B sp|Q71LE2.3|H33_PIG RecName: Full=Histone H3.3 sp|Q5E9F8.3|H33_BOVIN RecName: Full=Histone H3.3 sp|Q6P823.3|H33_XENTR RecName: Full=Histone H3.3 sp|Q6PI20.3|H33_DANRE RecName: Full=Histone H3.3 sp|Q6PI79.3|H33_XENLA RecName: Full=Histone H3.3 gb|AAG17271.1|AF218029_1 unknown [Homo sapiens] gb|AAL76273.1|AF469469_1 histone H3.3A [Sus scrofa] emb|CAA36179.1| unnamed protein product [Oryctolagus cuniculus] emb|CAA37819.1| Histone H3.3Q [Drosophila melanogaster] emb|CAA31940.1| unnamed protein product [Mus musculus] emb|CAA68458.1| unnamed protein product [Gallus gallus] gb|AAA29965.1| histone H3 [Spisula solidissima] gb|AAA48794.1| histone 3.3 [Gallus gallus] gb|AAA52653.1| H3.3 histone [Homo sapiens] gb|AAA52654.1| H3.3 histone [Homo sapiens] emb|CAA52035.1| histon H3 [Rattus norvegicus] emb|CAA88778.1| histone H3.3 [Homo sapiens] emb|CAA57078.1| histone H3.3 [Drosophila hydei] emb|CAA57081.1| histone H3.3 [Drosophila hydei] emb|CAA57080.1| histone H3.3 [Drosophila melanogaster] emb|CAA57077.1| histone H3.3 [Drosophila melanogaster] emb|CAA57712.1| histone H3.3A variant [Drosophila melanogaster] emb|CAB06625.1| histone H3.3A [Mus musculus] gb|AAF46452.1| histone H3.3B, isoform A [Drosophila melanogaster] gb|AAF52213.1| histone H3.3A, isoform A [Drosophila melanogaster] gb|AAH01124.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAH02268.1| H3 histone, family 3A [Mus musculus] dbj|BAB22464.1| unnamed protein product [Mus musculus] gb|AAH06497.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAH12687.1| H3 histone, family 3A [Mus musculus] gb|AAH12813.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAK61362.1| histone 3A [Anopheles gambiae] gb|AAH17558.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAL48679.1| RE14004p [Drosophila melanogaster] gb|AAH29405.1| H3 histone, family 3A [Homo sapiens] gb|AAM48354.1| LD17717p [Drosophila melanogaster] gb|AAM50283.1| RE21618p [Drosophila melanogaster] gb|AAN09245.1| histone H3.3B, isoform B [Drosophila melanogaster] gb|AAH37730.1| H3 histone, family 3B [Mus musculus] gb|AAH38989.1| H3 histone, family 3A [Homo sapiens] dbj|BAC29895.1| unnamed protein product [Mus musculus] dbj|BAC40130.1| unnamed protein product [Mus musculus] gb|AAH41218.1| MGC52708 protein [Xenopus laevis] gb|AAH42290.1| H3f3b-prov protein [Xenopus laevis] gb|AAH42309.1| H3f3a-prov protein [Xenopus laevis] gb|AAO41645.1| histone H3.3B, isoform C [Drosophila melanogaster] gb|AAH49017.1| Zgc:56418 [Danio rerio] gb|EAA01174.2| AGAP001813-PA [Anopheles gambiae str. PEST] emb|CAD97621.1| hypothetical protein [Homo sapiens] gb|AAH57444.1| H3 histone, family 3C [Danio rerio] gb|AAR09797.1| similar to Drosophila melanogaster His3.3A, partial [Drosophila yakuba] gb|AAH61408.1| H3 histone, family 3B (H3.3B) [Xenopus (Silurana) tropicalis] gb|AAH63159.1| H3 histone, family 3B [Rattus norvegicus] emb|CAG02570.1| unnamed protein product [Tetraodon nigroviridis] emb|CAG02722.1| unnamed protein product [Tetraodon nigroviridis] emb|CAG06431.1| unnamed protein product [Tetraodon nigroviridis] gb|AAH70966.1| MGC78769 protein [Xenopus laevis] emb|CAF25046.1| histone H3.3 [Oikopleura dioica] gb|AAH71406.1| H3 histone, family 3A [Danio rerio] gb|AAH74158.1| MGC81913 protein [Xenopus laevis] gb|AAH77035.1| MGC89877 protein [Xenopus (Silurana) tropicalis] gb|AAH78759.1| H3 histone, family 3B [Rattus norvegicus] gb|AAU09479.1| GekBS038P [Gekko japonicus] gb|AAH81560.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAH83353.1| H3 histone, family 3A [Mus musculus] gb|EAL33023.1| GA19158 [Drosophila pseudoobscura pseudoobscura] emb|CAH73372.1| H3 histone, family 3A [Homo sapiens] gb|AAH86580.1| H3f3b protein [Rattus norvegicus] gb|AAH87725.1| H3f3b protein [Rattus norvegicus] gb|AAH88835.1| H3 histone, family 3A [Mus musculus] gb|AAX08979.1| H3 histone, family 3A [Bos taurus] gb|AAX19363.1| replacement histone H3.3 [Ruditapes philippinarum] gb|AAH92043.1| H3 histone, family 3B [Mus musculus] gb|AAH92854.1| Zgc:110292 [Danio rerio] gb|AAH95447.1| H3 histone, family 3A [Homo sapiens] gb|AAI03072.1| H3F3A protein [Bos taurus] dbj|BAE40831.1| unnamed protein product [Mus musculus] dbj|BAE31831.1| unnamed protein product [Mus musculus] dbj|BAE35953.1| unnamed protein product [Mus musculus] dbj|BAE40995.1| unnamed protein product [Mus musculus] dbj|BAE31877.1| unnamed protein product [Mus musculus] dbj|BAE31939.1| unnamed protein product [Mus musculus] dbj|BAE29685.1| unnamed protein product [Mus musculus] dbj|BAE32069.1| unnamed protein product [Mus musculus] dbj|BAE36524.1| unnamed protein product [Mus musculus] dbj|BAE29966.1| unnamed protein product [Mus musculus] dbj|BAE36694.1| unnamed protein product [Mus musculus] dbj|BAE22687.1| unnamed protein product [Mus musculus] dbj|BAE37253.1| unnamed protein product [Mus musculus] dbj|BAE30261.1| unnamed protein product [Mus musculus] dbj|BAE30314.1| unnamed protein product [Mus musculus] dbj|BAE30566.1| unnamed protein product [Mus musculus] dbj|BAE30586.1| unnamed protein product [Mus musculus] dbj|BAE30589.1| unnamed protein product [Mus musculus] dbj|BAE35232.1| unnamed protein product [Mus musculus] dbj|BAE39850.1| unnamed protein product [Mus musculus] dbj|BAE39892.1| unnamed protein product [Mus musculus] dbj|BAE35427.1| unnamed protein product [Mus musculus] dbj|BAE30757.1| unnamed protein product [Mus musculus] dbj|BAE40157.1| unnamed protein product [Mus musculus] dbj|BAE31102.1| unnamed protein product [Mus musculus] dbj|BAE31231.1| unnamed protein product [Mus musculus] dbj|BAE31233.1| unnamed protein product [Mus musculus] dbj|BAE29584.1| unnamed protein product [Mus musculus] dbj|BAE29585.1| unnamed protein product [Mus musculus] dbj|BAE40542.1| unnamed protein product [Mus musculus] dbj|BAE31366.1| unnamed protein product [Mus musculus] dbj|BAE31590.1| unnamed protein product [Mus musculus] dbj|BAE31666.1| unnamed protein product [Mus musculus] gb|AAI06303.1| MGC52708 protein [Xenopus laevis] gb|AAI06178.1| H3 histone, family 3A [Mus musculus] gb|AAI08702.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|ABD36130.1| h3 histone family 3a [Bombyx mori] gb|ABD98756.1| putative H3 histone, family 3A [Graphocephala atropunctata] gb|ABF57428.1| H3 histone, family 3B [Bos taurus] gb|EAT42283.1| histone H3.3 [Aedes aegypti] gb|ABG43104.1| histone H3 [Pectinaria gouldii] emb|CAL49400.1| H3 histone [Xenopus (Silurana) tropicalis] gb|AAI23121.1| MGC52708 protein [Xenopus laevis] emb|CAL38070.1| hypothetical protein [synthetic construct] gb|EAW69770.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW69771.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW69772.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW69773.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW89317.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gb|EAW89318.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gb|EAW89319.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gb|ABM55584.1| putative histone H3 [Maconellicoccus hirsutus] gb|ABM55592.1| putative H3 histone, family 3B [Maconellicoccus hirsutus] emb|CAM24039.1| H3 histone, family 3B [Mus musculus] gb|ABM83541.1| H3 histone, family 3A [synthetic construct] gb|ABM86781.1| H3 histone, family 3A [synthetic construct] emb|CAK32534.1| histone H3.3 [Oikopleura dioica] gb|AAI34735.1| H3 histone, family 3A [Bos taurus] dbj|BAF62355.1| H3 histone, family 3A [Pan troglodytes verus] gb|EDL13145.1| mCG19829 [Mus musculus] gb|EDL34545.1| mCG6618 [Mus musculus] gb|EDL94833.1| rCG20294, isoform CRA_a [Rattus norvegicus] gb|EDM06637.1| H3 histone, family 3B, isoform CRA_a [Rattus norvegicus] gb|ABR22618.1| histone 3 [Aplysia californica] gb|ABR27830.1| H3 histone family 3B [Triatoma infestans] gb|AAI52135.1| Zgc:64222 protein [Danio rerio] gb|AAI54270.1| Zgc:56418 protein [Danio rerio] gb|EDP32269.1| Histone H3.3, putative [Brugia malayi] gb|EDP33668.1| Histone H3.3, putative [Brugia malayi] gb|AAI55446.1| h3f3b protein [Xenopus (Silurana) tropicalis] gb|ABX89280.1| histone cluster 1, H3a (predicted) [Papio anubis] gb|AAI57317.1| MGC89877 protein [Xenopus (Silurana) tropicalis] gb|AAI57315.1| h3f3b protein [Xenopus (Silurana) tropicalis] gb|AAI58616.1| H3f3b protein [Rattus norvegicus] gb|AAI59440.1| H3f3b protein [Rattus norvegicus] gb|ABZ92486.1| H3 histone, family 3B (H3.3B) [synthetic construct] gb|EDS44786.1| histone H3.3 type 2 [Culex quinquefasciatus] gb|AAI65500.1| H3f3c protein [Danio rerio] dbj|BAG34846.1| unnamed protein product [Homo sapiens] gb|EDV32216.1| GF15720 [Drosophila ananassae] gb|EDV33762.1| GF19171 [Drosophila ananassae] gb|EDV46293.1| GG19000 [Drosophila erecta] gb|EDV57824.1| GG25048 [Drosophila erecta] gb|EDV92098.1| GH24723 [Drosophila grimshawi] gb|EDW03888.1| GH11489 [Drosophila grimshawi] gb|EDW07414.1| GI14879 [Drosophila mojavensis] gb|EDW11127.1| GI16984 [Drosophila mojavensis] gb|EDW25354.1| GL26550 [Drosophila persimilis] gb|EDW30520.1| GL26831 [Drosophila persimilis] gb|EDW51275.1| GM13676 [Drosophila sechellia] gb|EDW54332.1| GM18523 [Drosophila sechellia] gb|EDW58018.1| GJ15308 [Drosophila virilis] gb|EDW64014.1| GJ17231 [Drosophila virilis] gb|EDW75486.1| GK23881 [Drosophila willistoni] gb|EDW82368.1| GK25162 [Drosophila willistoni] gb|EDW88387.1| His3.3A [Drosophila yakuba] gb|EDX02176.1| GE17412 [Drosophila yakuba] gb|EDX03788.1| GD23319 [Drosophila simulans] gb|ACH44318.1| putative H3 histone family 3A [Taeniopygia guttata] gb|ACH44319.1| putative H3 histone family 3A [Taeniopygia guttata] gb|ACH46260.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46261.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46263.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46264.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46265.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46266.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46267.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46268.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46269.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46270.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46338.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46375.1| putative H3 histone family 3A [Taeniopygia guttata] gb|ACH70745.1| H3 histone family 3A [Salmo salar] gb|EDY72858.1| GA22698 [Drosophila pseudoobscura pseudoobscura] dbj|BAG73253.1| Histone H3.3 [synthetic construct] gb|ACI33069.1| Histone H3.3 [Salmo salar] gb|ACI33957.1| Histone H3.3 [Salmo salar] gb|ACI34226.1| Histone H3.3 [Salmo salar] gb|ACI67089.1| Histone H3.3 [Salmo salar] gb|ACI67783.1| Histone H3.3 [Salmo salar] gb|ACI68375.1| Histone H3.3 [Salmo salar] gb|ACI69310.1| Histone H3.3 [Salmo salar] gb|ACI70069.1| Histone H3.3 [Salmo salar] gb|EEB17922.1| histone H3.3 [Pediculus humanus corporis] gb|EEC02656.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis] gb|ACL87760.1| His3.3A-PA [synthetic construct] gb|ACL92191.1| His3.3A-PA [synthetic construct] gb|ACL92440.1| His3.3A-PA [synthetic construct] gb|ACM08300.1| Histone H3.3 [Salmo salar] gb|ACM08661.1| Histone H3.3 [Salmo salar] gb|ACM08967.1| Histone H3.3 [Salmo salar] gb|ACM09352.1| Histone H3.3 [Salmo salar] gb|ACM09780.1| Histone H3.3 [Salmo salar] gb|ACN10203.1| Histone H3.3 [Salmo salar] gb|ACN10246.1| Histone H3.3 [Salmo salar] gb|ACN12557.1| Histone H3.3 [Salmo salar] gb|ACN12601.1| Histone H3.3 [Salmo salar] gb|ACN69167.1| H3 histone family 3A [Stomoxys calcitrans] gb|ACO07595.1| Histone H3.3 [Oncorhynchus mykiss] gb|ACO09276.1| Histone H3.3 [Osmerus mordax] gb|ACO09281.1| Histone H3.3 [Osmerus mordax] gb|ACO12781.1| Histone H3.3 [Lepeophtheirus salmonis] gb|ACO12834.1| Histone H3.3 [Lepeophtheirus salmonis] gb|ACO14940.1| Histone H3.3 [Caligus clemensi] gb|ACO15238.1| Histone H3.3 [Caligus clemensi] gb|ACO15474.1| Histone H3.3 [Caligus clemensi] gb|EEN45251.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae] gb|EEN51635.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae] gb|ACQ58573.1| Histone H3.3 [Anoplopoma fimbria] emb|CBH09251.1| putative Histone H3 [Heliconius melpomene] dbj|BAI46602.1| H3 histone, family 3A [synthetic construct] gb|EFA07829.1| hypothetical protein TcasGA2_TC005398 [Tribolium castaneum] gb|EFB25626.1| hypothetical protein PANDA_008580 [Ailuropoda melanoleuca] gb|EFB29651.1| hypothetical protein PANDA_016437 [Ailuropoda melanoleuca] emb|CAP53904.1| histone H3.3 [Xenoturbella bocki] emb|CAP57915.1| histone H3.3 [Xenoturbella bocki] gb|ADD20321.1| H3 histone family 3A [Glossina morsitans morsitans] gb|ADD20322.1| H3 histone family 3A [Glossina morsitans morsitans] gb|ADD20325.1| H3 histone family 3A [Glossina morsitans morsitans] gb|ADD38620.1| Histone H3.3 [Lepeophtheirus salmonis] gb|ADD38769.1| Histone H3.3 [Lepeophtheirus salmonis] dbj|BAI83414.1| histone H3 [Parasteatoda tepidariorum] gb|DAA18137.1| histone H3.3B-like [Bos taurus] gb|DAA21369.1| histone H3.3 [Bos taurus] gb|ADM15975.1| Histone H3.3 [Salmo salar] gb|ADM16206.1| Histone H3.3 [Salmo salar] gb|ADN29851.1| histone H3.3 [Triatoma matogrossensis] gb|EFN62078.1| Histone H3.3 [Camponotus floridanus] gb|EFN83154.1| Histone H3.3 [Harpegnathos saltator] gb|EFO14545.1| histone H3 [Loa loa] gb|EFO23321.1| H3 histone, family 3A [Loa loa] gb|ADO27848.1| histone h3.3 [Ictalurus furcatus] gb|ADO28924.1| histone h3.3 [Ictalurus punctatus] gb|EFR19783.1| hypothetical protein AND_30674 [Anopheles darlingi] emb|CBY30878.1| unnamed protein product [Oikopleura dioica] emb|CBY10218.1| unnamed protein product [Oikopleura dioica] emb|CBY25129.1| unnamed protein product [Oikopleura dioica] emb|CBN81162.1| Histone H3 [Dicentrarchus labrax] emb|CBN81301.1| Uncharacterized protein [Dicentrarchus labrax] gb|EFX74442.1| hypothetical protein DAPPUDRAFT_231307 [Daphnia pulex] gb|ADY44152.1| Histone H3.3 [Ascaris suum] tpg|DAA34575.1| TPA_exp: H3 histone family 3A [Amblyomma variegatum] gb|EGI68969.1| Histone H3.3 [Acromyrmex echinatior] gb|EGI68970.1| Histone H3.3 [Acromyrmex echinatior] gb|EGK97461.1| AGAP001813-PB [Anopheles gambiae str. PEST] emb|CBM82511.1| histone H3.3 protein [Balanoglossus clavigerus] gb|AEM37650.1| histone H3 [Epinephelus bruneus] dbj|BAK63626.1| histone H3.3 [Pan troglodytes] gb|EHB06352.1| Histone H3.3 [Heterocephalus glaber] gb|EHB10765.1| Histone H3.3 [Heterocephalus glaber] gb|EHH15496.1| hypothetical protein EGK_01597 [Macaca mulatta] gb|EHH25207.1| hypothetical protein EGK_08989 [Macaca mulatta] gb|EHH50500.1| hypothetical protein EGM_01343 [Macaca fascicularis] gb|EHH61688.1| hypothetical protein EGM_19729 [Macaca fascicularis] gb|EHJ77454.1| hypothetical protein KGM_11308 [Danaus plexippus] 6e-72
InterPro IPR000164 Histone H3
InterPro IPR009072 Histone-fold
InterPro IPR007125 Histone core
Gene Ontology(BP) GO:0006334 nucleosome assembly
Gene Ontology(CC) GO:0000786 nucleosome
Gene Ontology(MF) GO:0003677 DNA binding
Pfam PF00125.19 Core histone H2A/H2B/H3/H4 3.8e-33
Pfam PF00808.18 Histone-like transcription factor (CBF/NF-Y) and archaeal histone 0.052

Expression level (RPKM)

Paralog/Ortholog genes

Paralogous genes

Gene ID

Orthologous genes

Species Gene ID
N. vitripennis NV14154-PA
D. melanogaster FBgn0004828
D. plexippus DPOGS200276PA
C. quinquefasciatus CPIJ017187
H. sapiens ENSP00000355778
H. sapiens ENSP00000468714
P. humanus PHUM492720-PA
H. sapiens ENSP00000355781
P. vanderplanki Pv.09933
A. mellifera GB12948-PA
A. aegypti AAEL006158
N. vitripennis NV14153-PB
A. gambiae AGAP001813
H. sapiens ENSP00000466020
T. castaneum TC005398
H. melpomene HMEL000014-PA
H. sapiens ENSP00000254810
A. mellifera GB11228-PA
B. mori BGIBMGA005550-TA
D. melanogaster FBgn0014857
H. sapiens ENSP00000465813
M. musculus ENSMUSG00000016559
H. sapiens ENSP00000355780