MidgeBase gene description page [Pn.05433]

Outline

Link to gbrowse

Gene ID Pn.05433
Type Protein coding gene
Scaffold PnScaf4743
Start 13523
End 13991
Direction -

Sequence

Transcript: 408 (bp)

 ATGGGAAAAATTATGAAAGCAGGAAAGGTTGTCATCGTCCTCGGTGGTCGATATGCAGGACGAAAAGCAGTGATTCTAAAGGCAATCGATGATGGCACAAATGAAAAACCATTTGCACAAGCATTGGTCGCTGGTATTTCACGCTATCCACGCCGTGTTGTTCGCCGAATGAAGAAAGATAAAATCAAGAAGAACATCCGCATCAAACCATTTATCAAGTGCATCAATTACAATCATTTGATGCCCACACGTTACAGTGTTTCTGACATAACATTGGATCAAAAATATGGCCTGAAGGATCTTCGAGATCCAGTTAAACGCAAGAAGGCTGCATTCCAAGTTCGCATGAAACTCGAAGATCGCTACAAGCAAGGCAAGAACAAGTGGTTCTTTCAAAAATTACGCTTC 

Protein: 136 (aa)

 MGKIMKAGKVVIVLGGRYAGRKAVILKAIDDGTNEKPFAQALVAGISRYPRRVVRRMKKDKIKKNIRIKPFIKCINYNHLMPTRYSVSDITLDQKYGLKDLRDPVKRKKAAFQVRMKLEDRYKQGKNKWFFQKLRF 
Type Start End Length
CDS 13526 13906 381
CDS 13965 13991 27
intron 13907 13964 58

Auto annotation result

Program/Analysis Accession Description Score/Expectation
BLASTP/NCBI-nr ACF72873 60S ribosomal protein L27e [Ochlerotatus taeniorhynchus] 7e-54
InterPro IPR018262 Ribosomal protein L27e, conserved site
InterPro IPR014722 Translation protein SH3-like, subgroup
InterPro IPR005824 KOW
InterPro IPR001141 Ribosomal protein L27e
Gene Ontology(BP) GO:0006412 translation
Gene Ontology(CC) GO:0005840 ribosome
Gene Ontology(CC) GO:0005622 intracellular
Gene Ontology(MF) GO:0003735 structural constituent of ribosome
Pfam PF01777.13 Ribosomal L27e protein family 4.7e-32
Pfam PF00467.24 KOW motif 1.6e-06

Expression level (RPKM)

Paralog/Ortholog genes

Paralogous genes

Gene ID

Orthologous genes

Species Gene ID
P. vanderplanki Pv.02400